General Information

  • ID:  hor006991
  • Uniprot ID:  P26441
  • Protein name:  Ciliary neurotrophic factor
  • Gene name:  TTR
  • Organism:  Homo sapiens
  • Family:  CNTF family
  • Source:  Human
  • Expression:  Nervous system.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human)
  • GO MF:  GO:0030424 axon; GO:0005737 cytoplasm; GO:0005576 extracellular region; GO:0005615 extracellular space
  • GO BP:  GO:0008083 growth factor activity; GO:0005125 cytokine activity; GO:0005127 ciliary neurotrophic factor receptor binding; GO:0044877 protein-containing complex binding; GO:0005138 interleukin-6 receptor binding
  • GO CC:  GO:0048666 neuron development; GO:0048680 positive regulation of axon regeneration; GO:0042531 positive regulation of tyrosine phosphorylation of STAT protein; GO:0010628 positive regulation of gene expression; GO:0008284 positive regulation of cell population proliferation; GO:0043524 negative regulation of neuron apoptotic process; GO:0048143 astrocyte activation; GO:0046533 negative regulation of photoreceptor cell differentiation; GO:0007165 signal transduction; GO:0048644 muscle organ morphogenesis; GO:0046668 regulation of retinal cell programmed cell death; GO:0070120 ciliary neurotrophic factor-mediated signaling pathway; GO:0060221 retinal rod cell differentiation

Sequence Information

  • Sequence:  AFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM
  • Length:  199
  • Propeptide:  MAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life / Aliphatic Index: Aliphatic Index:
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA